Recombinant Human IL-9 protein(N-His)(active)
| Specifications | |
|---|---|
| Molecular Weight: | 16.73 kDa |
| Tag: | N-His |
| Source: | E.coli |
| Purity: | >98% as determined by SDS-PAGE. |
| Endotoxin Level: | <0.01 EU per 1 μg of the protein by the LAL method. |
| Activity: | Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x106 IU/ mg. |
| Format: | Lyophilized from sterile PBS, pH 8.0 |
| Additional Information | |
|---|---|
| Synonyms: | p40 cytokine, T-cell growth factor p40 |
| Organism: | Human |
| Accn. No.: | P15248 |
Sequence Information
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Price
233,00 €
