Recombinant Human Noggin protein(C-His)(active)
| Specifications | |
|---|---|
| Molecular Weight: | 26.60 kDa |
| Tag: | C-His |
| Source: | E.coli |
| Purity: | >98% as determined by SDS-PAGE. |
| Endotoxin Level: | <0.1 EU per 1 μg of the protein by the LAL method. |
| Activity: | Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4. |
| Format: | Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0. |
| Additional Information | |
|---|---|
| Synonyms: | NOG; Noggin; SYM1; symphalangism 1 (proximal); synostoses (multiple) syndrome 1; SYNS1; SYNS1A |
| Organism: | Human |
| Accn. No.: | Q13253 |
Sequence Information
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Price
233,00 €
