Human Interleukin-35 (IL-35 Heterodimer)
| Specifications | |
|---|---|
| Molecular Weight: | 45.8/ 60-65 unreduced 70-80 reduced |
| Tag: | None |
| Source: | HEK 293 cells |
| Purity: | ≥95% |
| Activity: | NA |
| Activity Assay: | Not bioactive |
| Format: | Lyophilized from a 0.2 µm filtered solution containing 10 mM Sodium Phosphate, 30 mM Sodium Chloride, pH7.5 |
Sequence Information
EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Background
Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the interleukin 12 subunit P35 (IL-12a) and the interleukin 27 subunit beta (IL-27b) chains. IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
- Price
- Please inquire
